PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_020186-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family MYB
Protein Properties Length: 300aa    MW: 32322.9 Da    PI: 6.4249
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_020186-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding33.69e-111156346
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqk 46
                      W+ e d+ + +a++ ++ +   +W+ Ia+ ++ g+tl+++k+++  
  AHYPO_020186-RA 11 YWSIEQDKAFENAIATHPEElddRWEMIAADVP-GKTLEEVKNHYEL 56
                     5*****************99*************.***********75 PP

2Myb_DNA-binding24.47e-081421731647
                      HHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  16 vkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       +++G+g+W++I+r +  +Rt+ q+ s+ qky
  AHYPO_020186-RA 142 LNKYGKGDWRSISRNFVVTRTPTQVASHAQKY 173
                      689****************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500907.12458IPR017877Myb-like domain
SMARTSM007173.7E-7860IPR001005SANT/Myb domain
SuperFamilySSF466891.01E-101066IPR009057Homeodomain-like
PfamPF002492.2E-71155IPR001005SANT/Myb domain
CDDcd001672.56E-81258No hitNo description
Gene3DG3DSA:1.10.10.601.0E-41258IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-6112174IPR009057Homeodomain-like
PROSITE profilePS5129411.903113178IPR017930Myb domain
SuperFamilySSF466893.45E-11116179IPR009057Homeodomain-like
TIGRFAMsTIGR015573.1E-11118176IPR006447Myb domain, plants
SMARTSM007170.0011118176IPR001005SANT/Myb domain
CDDcd001672.13E-7121174No hitNo description
PfamPF002498.8E-6142173IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MAVDENGDSS YWSIEQDKAF ENAIATHPEE LDDRWEMIAA DVPGKTLEEV KNHYELLLED  60
VKQIESGRVP LPTYNSSSEG SSGFAAEEGN GKKGQCSNGV SEANHGSKAL RSDQERRKGI  120
AWTEDEHRQV YYLIFVFVSG LLNKYGKGDW RSISRNFVVT RTPTQVASHA QKYFIRLNSM  180
NKDRRRSSIH DITSVNTGDL SVPQGPITGQ TNASPAGASS VKSEKQAAQP PTASAGVGVY  240
ANPTIGQPIG GPLVSAVGTP VNLPNHMAYG VQAPIPGSVV SGAPMGMSPM QYPMPHTSVH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A3e-1812771176RADIALIS
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00500DAPTransfer from AT5G08520Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010671196.11e-162PREDICTED: transcription factor DIVARICATA
RefseqXP_010671200.11e-162PREDICTED: transcription factor DIVARICATA
RefseqXP_010671206.11e-162PREDICTED: transcription factor DIVARICATA
RefseqXP_010671212.11e-162PREDICTED: transcription factor DIVARICATA
RefseqXP_010671218.11e-162PREDICTED: transcription factor DIVARICATA
RefseqXP_010671224.11e-162PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H76e-56DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A0J8D8741e-162A0A0J8D874_BETVU; Uncharacterized protein
STRINGGLYMA07G28310.11e-149(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08520.11e-105MYB family protein